NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335017_0001593

Scaffold Ga0335017_0001593


Overview

Basic Information
Taxon OID3300034167 Open in IMG/M
Scaffold IDGa0335017_0001593 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11335
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (70.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylococcus → unclassified Methylococcus → Methylococcus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049614Metagenome / Metatranscriptome146N
F074551Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0335017_0001593_1604_1843F074551AGGGGGMTERLEDQILQQVLVIQALRLRIARMESIYTTPRAIKSTGMNGTTEDTPHKRDTIVDLGPADVRCVTDQEVERAEDDGT
Ga0335017_0001593_1840_2325F049614GAGGMINSRMKGKNGELDACRALGKVFPFAWERTAQRYGKGKADIEPCVDWKIHVEVKRRRTGYTYVYSRLAKDTLIISGSMLMCRLSHLRTVMDDSVCLPNVAPRNAGLEDAMLQARTDADSDMLPVVLARQDDEEWLLCWREENDTRLMEEVRTWLDGSTKPI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.