NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335017_0014245

Scaffold Ga0335017_0014245


Overview

Basic Information
Taxon OID3300034167 Open in IMG/M
Scaffold IDGa0335017_0014245 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4510
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002162Metagenome / Metatranscriptome588Y
F002357Metagenome / Metatranscriptome567Y
F007469Metagenome / Metatranscriptome350Y
F105165Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0335017_0014245_2614_2784F002162AGGAMPNYEYECDREGLSIVLQLPMEHEIPLCQGCGFELSRVYTAVPAIFKGKGWAGKGG
Ga0335017_0014245_2777_2977F007469AGGAGGMGELQIIDGSGLTATFTDDGVKLEPSTIKCDTCNDDRLLHEGDLLRCYVCHTINRIPYPVNRNLNA
Ga0335017_0014245_2978_3640F002357GGAGMAFNLEDYEDVATLNKWFIANYPMGRSDISVISHDPEKGFILVQATLWRDATDSAPAVSNIAFGSRETYMANMKKWYVEDTASSSLGRAIIILKGSNKTATKDSMETVKADQSFKEKLESRQNMYGKAGSKSAQIETILRDSFEADKPKDPVAWSVGDVVDQIAASIPNEPPACQHGHILKEGISKGGKPYYGYVCKAKACEPKWAKLTANGKWYFEGGE
Ga0335017_0014245_3916_4116F105165GGAGMTAKDDMLQLAWIFMGLGIGAWIIHEIKLSAQNRYYWIGRKDGWNMHRRMIDNKAKSDEVFDYDKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.