NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370480_0001325

Scaffold Ga0370480_0001325


Overview

Basic Information
Taxon OID3300034169 Open in IMG/M
Scaffold IDGa0370480_0001325 Open in IMG/M
Source Dataset NamePeat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10073
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (68.75%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)64.9142Long. (o)-147.835Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020200Metagenome225Y
F021563Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0370480_0001325_2603_2878F020200AGGMCWVCERLENLITGWNEERDFQEQTSSDDYHRGLSKGFSECVKDLSEAVASMRLKGLCGKFPEYDGPFDGKQRWDILNDILKLRDEDSNQE
Ga0370480_0001325_64_291F021563N/AMEDLKLILINQLKSKGIDPALIPAFLKALTSLISSEPKIELAQVNRKMHSLGWNEVAIDYHCLQIAIASIETDTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.