NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334932_003952

Scaffold Ga0334932_003952


Overview

Basic Information
Taxon OID3300034174 Open in IMG/M
Scaffold IDGa0334932_003952 Open in IMG/M
Source Dataset NameSub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2366
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044807Metagenome / Metatranscriptome154Y
F084448Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0334932_003952_1537_1863F084448GGAGGMSNFADGLFPGWLSFLMLLPFIMLGFGLWFICRAFTDKGGARQPDPEAQARVVVLPDRTQRPLYRVHQQIQASARPPPKPQPDEPDRGSGGRRRRRRHHSTTRLELRQ
Ga0334932_003952_854_1321F044807N/AMGLFMMVASATWGHAGAFTPFYRIAGVLDPAAFDISLEEAATGSRFWFEPQTALPGACIHLGLAGFFGMLFVLLAHEGRGARPAALVAAGAAWGLVVAVVMVPVLRLVGRSVGGGALIAELPAHLGWPTYLAMHVVYGLALGAVVALRATRRAHT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.