NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334938_005739

Scaffold Ga0334938_005739


Overview

Basic Information
Taxon OID3300034236 Open in IMG/M
Scaffold IDGa0334938_005739 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 34SMC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2581
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (6.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.3778Long. (o)-117.6098Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055342Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0334938_005739_1124_1486F055342AGCAGGMSQKQRAKYHVRKRIFLNRDLDMRAFAIGIVQDTREIPMENESDWKWGKIELSLGDCYRVVSFDFSMETKADRANSLYKIRRIAEIVNAVRDAMELEAESIERRKVSKPKAQAKAKSAAG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.