NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0372943_0844332

Scaffold Ga0372943_0844332


Overview

Basic Information
Taxon OID3300034268 Open in IMG/M
Scaffold IDGa0372943_0844332 Open in IMG/M
Source Dataset NameForest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)608
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Eldorado National Forest, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.7833Long. (o)-120.2976Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092269Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0372943_0844332_339_608F092269GGAMLLTKVALYRASVLADNLGIRLCAAALMVMPSALVFLLPVLALFGAPDDATLPGVSVHDGGAIWALLSFALGVGFAAAWMRIVFTGGRLL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.