NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334960_008686

Scaffold Ga0334960_008686


Overview

Basic Information
Taxon OID3300034402 Open in IMG/M
Scaffold IDGa0334960_008686 Open in IMG/M
Source Dataset NameSub-biocrust soil microbial communities from Mojave Desert, California, United States - 56SNS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1316
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037928Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0334960_008686_53_349F037928GGALSVVELRALEPVAGDERYLIFLRNWAGWTLAGAARPGAGGTAQVRSGAEPRPPTIYEVVVTRAVDDATSVPHGQPVLHWFDASLGPPRAVPFDFARGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.