NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334960_021708

Scaffold Ga0334960_021708


Overview

Basic Information
Taxon OID3300034402 Open in IMG/M
Scaffold IDGa0334960_021708 Open in IMG/M
Source Dataset NameSub-biocrust soil microbial communities from Mojave Desert, California, United States - 56SNS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)849
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027713Metagenome / Metatranscriptome193Y

Sequences

Protein IDFamilyRBSSequence
Ga0334960_021708_127_642F027713AGCAGVFAATMSAYPLTVDRFELSERWCGWTDVDVIFIAARAAIDAGPFDPPICEVVFDEEFDPFSVDTLEEAREHLRRNRVRSMDIILSHIDEDEARLTLRYSGERLQLNGYGSDWERARAAYDAAQAELAGHFGITTFKLPKLPRDTVAETRKRLVIEELEAALENVDWTIEDR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.