NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310143_00952

Scaffold Ga0310143_00952


Overview

Basic Information
Taxon OID3300034523 Open in IMG/M
Scaffold IDGa0310143_00952 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - K-4-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11427
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (82.61%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.812Long. (o)-98.262Alt. (m)Depth (m)2943
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001515Metagenome / Metatranscriptome679Y
F026858Metagenome / Metatranscriptome196Y
F041080Metagenome / Metatranscriptome160Y
F091587Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0310143_00952_3466_3768F091587GAGGMSYNPYGGGSGSIVVTPSKPIVTARRLGSPNARLTDTKHGKAVRRTRPRHAVTTNRPKVERVLPTLTEQEQERLARALALSEREREFRATLPSVHIDAND
Ga0310143_00952_4013_4201F026858GAGGMTHDNLLLNLTQREVEVIRMALRVQEDTHKRNDFPSLLLEVQDLRSKIADMIIDNARELTKA
Ga0310143_00952_6390_6653F041080GAGGMSASTILGLADELRIIADEISYNALDTSSDYPKRGTIVKALASQTRFKPKSMWVSLGNGAYKHLTGSKGLVTTHDRLEGYVEVVFEA
Ga0310143_00952_9583_9993F001515N/AMTNKSSFDLDFGYGRKGEQLVDELLTGGRTVEVKRDRKWAKTNNLYIETECFFKKIEDWAPSGLGVTEAAYWAFVLEESTLIVPTDALRYAVKEFGREITCNIPPNISKGYLITVDDLMSATRLYKKAKADELATN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.