NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370545_005079

Scaffold Ga0370545_005079


Overview

Basic Information
Taxon OID3300034643 Open in IMG/M
Scaffold IDGa0370545_005079 Open in IMG/M
Source Dataset NameMetatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1749
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000329Metagenome / Metatranscriptome1287Y
F006853Metagenome / Metatranscriptome363Y
F076253Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0370545_005079_1024_1317F000329AGGAGMEGKAMLAAQEARALSGESWPVGEPVTLVIEEERFFGWVASASQAHSLARVAIEFKRGSQRVQECIPVENIERLRDYLQAHPELRKAKEQGAPVRQG
Ga0370545_005079_3_113F076253AGGAGMTTTGAFSTALCDAVDAQLHALPSHPEAHLWPSEVVT
Ga0370545_005079_436_693F006853AGGAGMDLVIELDNEGRIWVSGSDGTGLAEAWLHGAHETPDALRASGLCLLEEKYTPGTWTSTTLDPQEIAGQLWVEVSHETYKERRVRG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.