NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0372973_043788

Scaffold Ga0372973_043788


Overview

Basic Information
Taxon OID3300034650 Open in IMG/M
Scaffold IDGa0372973_043788 Open in IMG/M
Source Dataset NameMetatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1600_MSt12 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)640
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006183Metagenome / Metatranscriptome379Y
F056637Metagenome / Metatranscriptome137N

Sequences

Protein IDFamilyRBSSequence
Ga0372973_043788_258_494F006183AGGMVMLPPEKVPVTPAGKPENVAPVAPVVLYLISVIGVFTQTVWLFVPGAEVRVMVGLGRTMMVPVAVFTPPQGPVTITT
Ga0372973_043788_3_224F006183AGGMVMLPPEKAPVKPSGKLNDAPVAPMVLYVIGVIAVFTQTVWLSVPAAEVRVMAVLGRTMMVPVAVTSPQGPVTS
Ga0372973_043788_528_638F056637N/AWLFVPGAEVRVMVLLGRTVMVPVAVTFPQTPVKVTV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.