NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326741_000685

Scaffold Ga0326741_000685


Overview

Basic Information
Taxon OID3300034654 Open in IMG/M
Scaffold IDGa0326741_000685 Open in IMG/M
Source Dataset NameSeawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8176
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)13.5136Long. (o)-44.9628Alt. (m)Depth (m)2244
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011408Metagenome / Metatranscriptome291Y
F013189Metagenome / Metatranscriptome273Y

Sequences

Protein IDFamilyRBSSequence
Ga0326741_000685_2749_3087F013189AGGAMEIERADKLTGNDHTRARNVAEHLDKKYPGWLWAVHVMDGVVTVKSMLLSGNWGFVLHEDKIDNDYRAVTLAGGEILERYKQKTNGFNQERYMDLKMDYKGQLDGDFSPGTA
Ga0326741_000685_5282_5611F011408N/AMDYYNPSDLNAEDLIKRARVGNATQEFIRTPTGLSIAARAINEYRDGIEAFQKMAMQEWVGSSEEELQQYRKISNNLATPIKLLHWLDAIMADGENAEAIAKYKDAGDI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.