NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326741_007510

Scaffold Ga0326741_007510


Overview

Basic Information
Taxon OID3300034654 Open in IMG/M
Scaffold IDGa0326741_007510 Open in IMG/M
Source Dataset NameSeawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2125
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)13.5136Long. (o)-44.9628Alt. (m)Depth (m)2244
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011291Metagenome / Metatranscriptome292Y
F064626Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0326741_007510_1614_2000F011291AGGMMEKFEINVWKDAELLSKEVVQFETRELCYEYVTKKYHSPGSWTGEHQNINGVTLHRPPVGIRVTWSKLPGPIYKPSKLNAEEKKLQRELYNSITVEEIPELGRNEMLAKVRKDYYGHPEARGIEDKK
Ga0326741_007510_704_982F064626AGAAGGMKELKKVTEKIKKVLIKAERDGEEFPWIVDQLSLIKMYDMGLPITMVLGLIDEFVEDVEERKRIKALEGFDEEHVRKVYDKVNIKWNDRNIN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.