NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326748_015879

Scaffold Ga0326748_015879


Overview

Basic Information
Taxon OID3300034656 Open in IMG/M
Scaffold IDGa0326748_015879 Open in IMG/M
Source Dataset NameSeawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)995
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)13.3325Long. (o)-44.9106Alt. (m)Depth (m)2477
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000730Metagenome / Metatranscriptome917Y
F060030Metagenome133N

Sequences

Protein IDFamilyRBSSequence
Ga0326748_015879_329_715F000730GAGLATEILPPEIIPFIWFGGIAITIYVFFHKFSDVIKEKFRHTTAAKRKEEKNIHTDGQIDDLVNNAPRMVNEINKIIAEQKSAGVPDEKMKSLYQKKQMLELVSNNTEVINIIGKPILKKAVSYINKVF
Ga0326748_015879_3_326F060030AGGLVIQKLLVEEGVKRGLKVSRDYSVSVLGYDFLGLVSRLVIFFITGFLINAYFQATISGGLWLNTVANLFGMKFPTTLPQWVTELFTTGYHNITFWQIVQVTAIIIVVV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.