NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310147_004430

Scaffold Ga0310147_004430


Overview

Basic Information
Taxon OID3300034683 Open in IMG/M
Scaffold IDGa0310147_004430 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - K-7-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9830
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.812Long. (o)-98.262Alt. (m)Depth (m)2943
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022008Metagenome / Metatranscriptome216Y
F082560Metagenome113N
F103496Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0310147_004430_5981_6334F022008AGGMTLSDIEILQSTLRDLSKQVQKLSEENRVSFNHIHDRLTRIETQMSERECQFKRYEKQLENHEVRIRTVEGELGTLRDVPERLWRVSMSNSKLTGMIAAAGGVGGLVATIIVKMLGD
Ga0310147_004430_6336_6563F103496AGGMPLDDRIRKLPLTKLIALCFTVFTCVLIVLDVTTLCPLTDKSADLLKWLGSTIIVGYFGKSAYEHKINTTSGMKQ
Ga0310147_004430_8207_8650F082560GAGMYAVIWRAWISLDGGIGMTEKAIVKKIQEWFKAKGGVCHKVHGGPLSAGFPDLIGCIEADAWVVEVKVPNAKPRVPKELRERSPKEMQEWMEKGATMLQAKTLYDWQCAGAIAMVATSVEDVERRYQEEYFGFSIGGKHYDRFRRTQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.