NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0372840_015957

Scaffold Ga0372840_015957


Overview

Basic Information
Taxon OID3300034695 Open in IMG/M
Scaffold IDGa0372840_015957 Open in IMG/M
Source Dataset NameSeawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2088
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NamePacific Ocean: Gulf of Alaska
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051480Metagenome / Metatranscriptome144Y
F068149Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0372840_015957_1390_1839F068149GAGMTLDEFQIKFLKFAEESVEPLKGDGYPVCPYAKSARIKEALQFIDAREDITVLESFDHIKYQMAIAWLGDVDDMSSIEKTCEELREKHPHLLYFPSTRTSGHFVKNFTDCVFIQRKSDLLEKREHLHENTTYYDSWPADYYKLIIGHDA
Ga0372840_015957_1820_2086F051480N/AWRRFGYRKFFRGLIASRQPEEIVKIVERYNKDLKKTEGSYIDLVIRSEGAVSYKDIMQMPVDSIKLMIERMNNRVDEINDANSKHRGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.