NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0373573_0051877

Scaffold Ga0373573_0051877


Overview

Basic Information
Taxon OID3300034782 Open in IMG/M
Scaffold IDGa0373573_0051877 Open in IMG/M
Source Dataset NameSediment microbial communities from coastal wetland in Texas, United States - D0606M02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1129
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Coastal Wetland In Texas, United States

Source Dataset Sampling Location
Location NameUSA: Texas
CoordinatesLat. (o)27.8962Long. (o)-97.0386Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011939Metagenome / Metatranscriptome285Y

Sequences

Protein IDFamilyRBSSequence
Ga0373573_0051877_257_520F011939AGGAGMPRLTIQLAEETLRDEVQRLDKRVQLIGVRQGKKKDEYRVTLLKDGRTGSASIKKDLIKQYLAAEGKDKALRKALGRAVSHLSIQYR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.