Basic Information | |
---|---|
Taxon OID | 3300034782 Open in IMG/M |
Scaffold ID | Ga0373573_0214289 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from coastal wetland in Texas, United States - D0606M02 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 601 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Coastal Wetland In Texas, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Texas | |||||||
Coordinates | Lat. (o) | 27.8962 | Long. (o) | -97.0386 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052283 | Metagenome / Metatranscriptome | 143 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0373573_0214289_274_495 | F052283 | AGGAG | MNTKQKSVIVGAIFGAALGALAGFLFTRGLEVPREEEEDQGLNLSSLPPGAVVALFIAIMGVLRGVAELGEQV |
⦗Top⦘ |