Scaffold Ga0325409_008178

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0325409_008178

Scaffold Ga0325409_008178

Overview

Basic Information
Taxon OID	3300034901 Open in IMG/M
Scaffold ID	Ga0325409_008178 Open in IMG/M
Source Dataset Name	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10925
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	32.1348	Long. (^o)	-81.9657	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001798	Metagenome	632	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0325409_008178_106_309	F001798	N/A	VDLVDSSTQALWLDEMTLIHSEFGKVFLMKVVGNHLIFLPIKCQSIWITRARDMAKILSSAVGGRGG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.