NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS020869_Baylor_scaffold_16683

Scaffold SRS020869_Baylor_scaffold_16683


Overview

Basic Information
Taxon OID7000000172 Open in IMG/M
Scaffold IDSRS020869_Baylor_scaffold_16683 Open in IMG/M
Source Dataset NameHuman stool microbial communities from NIH, USA - visit 1, subject 160765029
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11654
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043945Metagenome155N
F091068Metagenome108N

Sequences

Protein IDFamilyRBSSequence
SRS020869_Baylor_scaffold_16683__gene_42060F043945N/AMAFLSLLLVLTLGVMPVFAESADHAMDWTHGIGSRYRTDVTSALPFEDELFFISGSQLLRVDDPEYEPEVVCNLEDVIWSEALKQSGYYGQVMLLSGGAELVLFSANEGRLYSFVPPTDDTMVRMQMVAELNYSTVPQMGWKKFPIAKDLYDVTVEQAVYDAQYGLYVIAKDKTDEYQIVWFDLDTGKGEMLEFALEDDENSHLLTDMPGIFQWSGTSSKYERTLYDGKVLTTVDLSSGEATKAVHNWVNTLTLQPIPDYDVTLGDYVTHDAYYAYAPNKDNSAMYFVHDNTVWVMEYDEENSQFSEPHGIDKLPFFAEDTMCGFYWRGFYLIQTHDGLYLCHTGDETARAYLYGEVE
SRS020869_Baylor_scaffold_16683__gene_42062F091068AGGAGGMNEKNQQVSDEQIDALIRSGLWQDEQPLTADEEKLADAAFARAMAKIDRKAKRQKHRTVLHMLDRVVRVAACLIVAVGIAFPIALANSEAFREQILQLVLSINPETGMAHVGMEPAKEERTANVPRMDVPDGWEGLFFPTFLPDDLPLVRCETTRGDQVHSEAYYADETRSLRFEEQDNLDGWNVRAADARVLTIYLHSVPGYLIDRQTEDTHEVSIIWSEGKRMLRVTSIGLPADEAVLVAQSVKKIFAE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.