NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS022077_Baylor_scaffold_57483

Scaffold SRS022077_Baylor_scaffold_57483


Overview

Basic Information
Taxon OID7000000194 Open in IMG/M
Scaffold IDSRS022077_Baylor_scaffold_57483 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 2, subject 158337416
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)47626
Total Scaffold Genes43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (13.95%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080165Metagenome115N
F090516Metagenome108N

Sequences

Protein IDFamilyRBSSequence
SRS022077_Baylor_scaffold_57483__gene_88193F080165N/AMKSIKILLLLLSLTACNNKTKTISTLDLEKTIINYKDLPSKVKERVFYGEAMKLGEEDEERFQDFQETNNPKKYEYYTKQNPQLAWVHYPYIRNKKTKQEYSIDKDGPMGSRYIIYGDSLYISNHYNIYEEDSLRYTFTRYILR
SRS022077_Baylor_scaffold_57483__gene_88210F090516N/AMKSNLSLKLFLAFERYFIENDEVISLDKSSEFTDVIVGIGFLPQDMSENTDFKKKTIEKYGFSSSTALADDFRKRVLNIDEPIPENFEKDGIGYVYTVISGYDTFYNRMYMFGIHCFNGDFNVTYFDLDNDAGTGDYYEEHELYSQAKGYRWLDPESDYYEDVLAWEALNKLATDIYFHLEDKLDVKIDIEPIPEEEKVVPTQEHLAKFLAFCGVEQDVIDENKERLLRALEEYTSDEYEGVSDAMAEMMEYSHKIQRAEPVIEIIREYGVCRFSDWKFYAEELEEYILDLADFSDWKWEYPEDTYSADLFPYMRKQLSLYHLWLCHLDEGADAYLFLLFSEKDMPEIMKLARILDLPLKAYFK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.