NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS016043_WUGC_scaffold_9044

Scaffold SRS016043_WUGC_scaffold_9044


Overview

Basic Information
Taxon OID7000000261 Open in IMG/M
Scaffold IDSRS016043_WUGC_scaffold_9044 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 764508039
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)57074
Total Scaffold Genes74 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)65 (87.84%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081510Metagenome114N

Sequences

Protein IDFamilyRBSSequence
SRS016043_WUGC_scaffold_9044__gene_11163F081510AGGAGMKLPKLPNMQTIKSTAKSAMVTTKILGKKYAPFVLLGVGLVGYGYSVYAGVKSGKKLEATKAKYEAKDAAGEEYTRMEVVKDVAKDVAIPVAVATASTAAIVLGFAIQTNRLKAVSSALAIVTEEHARYRLRAKEVLDEATFKKIDAPLETKTVELDGQEVEVESIVPNEGDFYGQWFKYSTNYVSDDPDYNESYIKEAEKYLVDRMMRKGVLTFGEVLDKLGFDVPRAALPFGWTDTDDFYIEWDAHEVFDDVKQEYDLQFYVRWKTPRNLYATTSFKDFVPKKTRKELN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.