Scaffold C8475572

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold C8475572

Scaffold C8475572

Overview

Basic Information
Taxon OID	7000000282 Open in IMG/M
Scaffold ID	C8475572 Open in IMG/M
Source Dataset Name	Human stool microbial communities from NIH, USA - visit 2, subject 763678604
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3816
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location Name	USA: Maryland: Natonal Institute of Health
Coordinates	Lat. (^o)	39.0042816	Long. (^o)	-77.1012173	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077319	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
C8475572__gene_265740	F077319	N/A	FSAGFNIRRSFYAGKHRLRGELYGARKAWRSKIMLIRNATLQMNATECACMDVRVMNGCVWEMGAALVKGLYESETDLCGDVLMPGRMLETPISAADEKALRLLCRRLYREGVRYFVADCPADALLRVQNRPERRGALPVTALPNPEPLRSGTGMPLTRWTAAGEFVGMMDEHSGD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.