Scaffold SRS016746_Baylor_scaffold_1161

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SRS016746_Baylor_scaffold_1161

Scaffold SRS016746_Baylor_scaffold_1161

Overview

Basic Information
Taxon OID	7000000650 Open in IMG/M
Scaffold ID	SRS016746_Baylor_scaffold_1161 Open in IMG/M
Source Dataset Name	Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160421117
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1867
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location Name	National Institutes of Health, USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051212	Metagenome	144	N

Sequences

Protein ID	Family	RBS	Sequence
SRS016746_Baylor_scaffold_1161__gene_1308	F051212	N/A	MKKFFFIFVLYWLHSCNGTEKAMATSPDTQKTSISEKQNAEKIERIIYSQTGGDTGGKNVHLVITKDSIIYHLTEGVTDEKTIANLSLNNNNKDWEAFIDKIDLEDFEKGKPSKELIMDLPTTKIIIKTDKKEYSKTNIQNNKTWDYITKQIIDIKFSQLNNHLNLEK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.