NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS044662_LANL_scaffold_49165

Scaffold SRS044662_LANL_scaffold_49165


Overview

Basic Information
Taxon OID7000000716 Open in IMG/M
Scaffold IDSRS044662_LANL_scaffold_49165 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 2, subject 370425937
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1478
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046433Metagenome151N

Sequences

Protein IDFamilyRBSSequence
SRS044662_LANL_scaffold_49165__gene_109267F046433N/AMIELPTSPDALSELNSVTPPDLTLQARDTSRNNPVTYVVDDGYMGTRTSDPRFRKMRRETTEYKALNEFLYFMKMVEPYVPDHIKDDARELRNELVFLGMSELHFAATALAKRLRHLLKVDNNPVYVDVGNSLSQCRVKNEMKSSQYILSLVLSKFLDDEFEEYEGRLKVYGGRGEIDKSSKILFLDDWIIGGDQMRERISVFGAYNNPGAHKVSVLVMAASSNCIDNGIGADSLWGEATYPVEAYYRLKNDHNDWGVSRVTGIHSSTDSTFGCEVDDIAYRAIEGGVLKGERIDRLTLPALVNIVRPYRNGEDFDGLSRFRQLLEKG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.