Basic Information | |
---|---|
IMG/M Taxon OID | 2051223006 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045401 | Gp0051702 | Ga0011002 |
Sample Name | Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10374 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Maryland School of Medicine |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 64033979 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] lactaris | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Orebro University Hospital, Sweden | |||||||
Coordinates | Lat. (o) | 59.274717 | Long. (o) | 15.230656 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059106 | Metagenome | 134 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
mhc6a_MHC6A_contig48237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Mediterraneibacter → [Ruminococcus] lactaris | 1206 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
mhc6a_MHC6A_contig48237 | MHC6A_contig48237_metagene_gene_4 | F059106 | MHAIVWKIRVILLQTFVWIVDLKVRERLIEYLKKDIKYHRVIIGGLV |
⦗Top⦘ |