NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2077657010

2077657010: Saline water microbial communities from Great Salt Lake, Utah, sample from South Arm Stromatolite



Overview

Basic Information
IMG/M Taxon OID2077657010 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0060782 | Gp0051796 | Ga0026433
Sample NameSaline water microbial communities from Great Salt Lake, Utah, sample from South Arm Stromatolite
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size156436365
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline Water Microbial Communities From Great Salt Lake, Utah
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From Great Salt Lake, Utah

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomelakesaline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Hypersaline (saline)

Location Information
LocationGreat Salt Lake
CoordinatesLat. (o)41.454358Long. (o)-112.666397Alt. (m)N/ADepth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050177Metagenome145N
F084096Metagenome / Metatranscriptome112Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
GSLSAS_GLMUJHB02GM20NNot Available513Open in IMG/M
GSLSAS_GLMUJHB02HHSC7Not Available514Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
GSLSAS_GLMUJHB02GM20NGSLSAS_02734200F050177MARVPSDPPDDALTPQQLADRVDDVVNLTVEELEAFRESEYNEEYLEYNSERAQRGNEPLDDVIRLLDTPRDEWRDVDDGFNEIAEARELLDFQRRTQAQIKSQGLGTNTIAEYDDMTFREAASI
GSLSAS_GLMUJHB02HHSC7GSLSAS_00092930F084096LVGAGLVVPTSGTVQYEQIAGGITRDTLWDSLKIMPNTPSNLEVHCVLLNNITIKEVAKFTRNEMGGDLSEEVMRNGWTLSEALGVKWVITIKKGLVPTNTMYHFADPKFIGKSYMLEDTTMYIRREAYFIEFFAYESLGGTLGHSSGLARVDFT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.