NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2189573024

2189573024: Echo Passage metagenome



Overview

Basic Information
IMG/M Taxon OID2189573024 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0047522 | Gp0052336 | Ga0011089
Sample NameEcho Passage metagenome
Sequencing StatusFinished
Sequencing CenterArizona Genomics Institute
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size138499921
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSpeleothem And Rock Wall Surfaces Microbial Communities From Kartchner Caverns, Benson, Arizona, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces → Speleothem And Rock Wall Surfaces Microbial Communities From Kartchner Caverns, Benson, Arizona, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → cave wall → rock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationKartchner Caverns, Benson, Arizona, USA
CoordinatesLat. (o)31.837801Long. (o)-110.350292Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002666Metagenome / Metatranscriptome539Y
F009387Metagenome / Metatranscriptome318N
F015813Metagenome / Metatranscriptome252Y
F019464Metagenome229Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
GG70X8M02GXDWXAll Organisms → cellular organisms → Archaea520Open in IMG/M
GG70X8M02HCC7SAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
GG70X8M02JYTU8All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
KCEPM_contig00149All Organisms → cellular organisms → Bacteria2441Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
GG70X8M02GXDWXKCEPM_01667720F009387EEPVIYPAFVLAKFDTLRDEVLSRLGLHRGFPPRNEKRKRKEYAEALLRAFLPQTLSQIRGGKVAGVSMDQAAYFLSWVKTERPEGMEAVGAPKIIRTGFRPGGGGDPDFSYDEYVEFIEHFRDLAHKIPDEVLEAEKVQAAATLT
GG70X8M02HCC7SKCEPM_01885330F019464MAAFLRVLGIVVVATGLGTAAAAGWLLAGDAHFREVSAAYARHPEHALFQAEYVAAAARHYGLLAGVVGGLLGGLALGGMLLALGELLRRIPRG
GG70X8M02JYTU8KCEPM_02314630F015813KTMTTLSHTLRAKCRKALLAGVALSVLLTPTFARSAEREGSVLFFSLEDLQQVLSHPSLPSFSQLLPSFEWRERPEAGEQDGRLERNSRWGNGLGIDGYTRPGTRPLWGY
KCEPM_contig00149KCEPM_02328780F002666MRRFGRQCRGQGKVFVTLVRQTEKQLLETGQPVLPLAQAAQACVQSAAHLAEDQRARLATTLTAALAAHHQIATQSRRLTTGKPLTQCKIVNAYDPTIAPICKGKSNCPTQFGRKPGIIAEPASGFIFAFQLPVGNPSDASYVMPLVDKVQHALGRVASRPTLAIHSLAGDLALNDPTVRQTLHARGILTVGIPHTVEPLPPSPTPAEVRQMLTAAGLHSKRTPHQVQLACACGYSRPVIESIIASLLCRGAARISYKGHRGAIIHTGMAIMAHNAATLVRIHQQQLSKRAQKFRRLLRLKHHNVNQFKVSKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.