 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2236876018 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0050867 | Gp0052555 | Ga0011263 |
| Sample Name | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS33 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 219035789 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → unclassified bacterial viruses → environmental samples → environmental Halophage eHP-30 | 1 |
| All Organisms → Viruses → environmental samples → uncultured virus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → saline evaporation pond → saline water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Spain: Bras del Port | |||||||
| Coordinates | Lat. (o) | 38.11 | Long. (o) | -0.36 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062484 | Metagenome | 130 | Y |
| F072017 | Metagenome | 121 | Y |
| F076468 | Metagenome | 118 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SS33_p0279325 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → environmental Halophage eHP-30 | 542 | Open in IMG/M |
| SS33_p0943507 | All Organisms → Viruses → environmental samples → uncultured virus | 508 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SS33_p0279325 | SS33_02793252 | F062484 | MWLIGSKTDIETYIAKVDKAEGFTGNLTKSWAEPRKHPDKDLYACPKNESVEPDSQLTEKEELPED |
| SS33_p0736880 | SS33_07368801 | F076468 | TKAVWLSGRYWRRESKVVHIDGDCDQLDSCDNPRGPVDPSVLQPDMAVCKRCDPTEPDQYGGSGTSLAHRLRHGDLQDATIDSDSVGGDE |
| SS33_p0943507 | SS33_09435071 | F072017 | WENRNMSLNQTPSLESQGDTNLKSTVHKHDEIHAVTQEQIDVLTANDRLLDFYEWQQII |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |