NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2236876021

2236876021: Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS37



Overview

Basic Information
IMG/M Taxon OID2236876021 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0050867 | Gp0053515 | Ga0011272
Sample NameSaline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS37
Sequencing StatusPermanent Draft
Sequencing CenterGATC-Biotech AG, Konstanz, Germany
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size269809237
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomesaline evaporation pondsaline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Hypersaline (saline)

Location Information
LocationBras del Port Saltern, Santa Pola, Spain
CoordinatesLat. (o)38.11Long. (o)-0.36Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088354Metagenome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SS37_p0049369Not Available507Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SS37_p0049369SS37_00493693F088354NDNAKTNPTKPMTDTPRTQLDVDRFETAVVNANGQVYLGRDLEGAKVHVAVEIVEDADEQEDPDQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.