Basic Information | |
---|---|
IMG/M Taxon OID | 2236876021 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0050867 | Gp0053515 | Ga0011272 |
Sample Name | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS37 |
Sequencing Status | Permanent Draft |
Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 269809237 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | aquatic biome → saline evaporation pond → saline water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Bras del Port Saltern, Santa Pola, Spain | |||||||
Coordinates | Lat. (o) | 38.11 | Long. (o) | -0.36 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088354 | Metagenome | 109 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
SS37_p0049369 | Not Available | 507 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
SS37_p0049369 | SS37_00493693 | F088354 | NDNAKTNPTKPMTDTPRTQLDVDRFETAVVNANGQVYLGRDLEGAKVHVAVEIVEDADEQEDPDQ |
⦗Top⦘ |