NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000147

3300000147: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 150m



Overview

Basic Information
IMG/M Taxon OID3300000147 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046785 | Gp0054201 | Ga0026212
Sample NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 150m
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size40969333
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon2
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → coastal inlet → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSaanich Inlet 54, Vancouver Island, BC, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)N/ADepth (m)150
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001887Metagenome / Metatranscriptome622Y
F029271Metagenome / Metatranscriptome189N
F031649Metagenome182Y
F059474Metagenome / Metatranscriptome134Y
F060973Metagenome / Metatranscriptome132Y
F091863Metagenome107N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SI54feb11_150mDRAFT_c1011221Not Available664Open in IMG/M
SI54feb11_150mDRAFT_c1012354All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon625Open in IMG/M
SI54feb11_150mDRAFT_c1012457All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon622Open in IMG/M
SI54feb11_150mDRAFT_c1014471Not Available570Open in IMG/M
SI54feb11_150mDRAFT_c1015640All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium544Open in IMG/M
SI54feb11_150mDRAFT_c1017145Not Available516Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SI54feb11_150mDRAFT_c1011221SI54feb11_150mDRAFT_10112212F029271MSKLSDLQDIKELLDVDFRKDKFLDNQYNNSPSFNYDAAESYVANIHQFXSEKYGEAVIYNFMQEVESLRITTLKMYIESNIASYQKFGAQK*
SI54feb11_150mDRAFT_c1012354SI54feb11_150mDRAFT_10123541F091863LILITIRKGVMTMYELKCSKCDTIKTYTNKRSWYNARRCKSQCKPCQNKESSTYWKGRTKPNYPKKTNGKTTDGDWDRNCPDCNKVLYYSSKWGRDDAERNGRICNQCSAYKYKKSWNNVITDDHIKKMRATKAGFTSWEEYKQKYPSKKMYQNEVRRLTRKQPLHILPNYSKLEENWGKMGEDGAYQIDHIISINKGWKDMIPAEEI
SI54feb11_150mDRAFT_c1012457SI54feb11_150mDRAFT_10124572F001887RIAKPRKGRETPLDSKVQIPGFGVMTRKQMQGSIQRYLKEVTNYIKKGDAEKAYNTLYKREVLKGFLETEIKHSGK*
SI54feb11_150mDRAFT_c1014471SI54feb11_150mDRAFT_10144712F060973LSNKRYLSILDEIKKHGGEEGNTENPNENILLVDGLNLFIRCFSVIP
SI54feb11_150mDRAFT_c1015640SI54feb11_150mDRAFT_10156403F031649EELMEKVKNMLMGLVLVAMMYMLLVIAFILDGAPFHP*
SI54feb11_150mDRAFT_c1017145SI54feb11_150mDRAFT_10171451F059474IKVVSTDDPAIDLANSDIAAYIDSHDMNHLSFIDGEQPTTFHLGTITFMKFAEIKDKHISFDIGEAGQEIKTNLFGLTADSLRYSLKKADNLPFPIKVERGRLSDTTMDKLARLGIVEELGNVALSLNGFGDDEEKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.