Basic Information | |
---|---|
IMG/M Taxon OID | 3300000249 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046785 | Gp0054006 | Ga0026088 |
Sample Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P12 1000m |
Sequencing Status | Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 9631090 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine aphotic zone → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | P12, Pacific Ocean | |||||||
Coordinates | Lat. (o) | 48.97 | Long. (o) | -130.666667 | Alt. (m) | N/A | Depth (m) | 1000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004642 | Metagenome / Metatranscriptome | 429 | Y |
F101338 | Metagenome | 102 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
LPfeb09P121000mDRAFT_102282 | Not Available | 624 | Open in IMG/M |
LPfeb09P121000mDRAFT_103205 | Not Available | 545 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
LPfeb09P121000mDRAFT_102282 | LPfeb09P121000mDRAFT_1022821 | F101338 | FELYFHSYIFSLSIAVLGLVARAPAVYMPFFKRILCEGIISAVFLRLEIQVFVPCLTLLTLLTGVQ* |
LPfeb09P121000mDRAFT_103205 | LPfeb09P121000mDRAFT_1032051 | F004642 | VWLNKSKKFYDVPFWQFTMDGIQWMVLDERHGSASQFYSHYKLAKGHVICTGXGFGTREQWLASKPEVTKITVLEKFKEVIDYHKDIGTKWHDKIEIINCDANDYKGSCDFLSIDHYEYDXVLRILDSIKTVCNNITCESAWFWMLEPWIRLGYITDNTENPTIIPMKIRYGGKENDILE |
⦗Top⦘ |