NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000249

3300000249: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P12 1000m



Overview

Basic Information
IMG/M Taxon OID3300000249 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046785 | Gp0054006 | Ga0026088
Sample NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P12 1000m
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size9631090
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine aphotic zonesea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationP12, Pacific Ocean
CoordinatesLat. (o)48.97Long. (o)-130.666667Alt. (m)N/ADepth (m)1000
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004642Metagenome / Metatranscriptome429Y
F101338Metagenome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
LPfeb09P121000mDRAFT_102282Not Available624Open in IMG/M
LPfeb09P121000mDRAFT_103205Not Available545Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
LPfeb09P121000mDRAFT_102282LPfeb09P121000mDRAFT_1022821F101338FELYFHSYIFSLSIAVLGLVARAPAVYMPFFKRILCEGIISAVFLRLEIQVFVPCLTLLTLLTGVQ*
LPfeb09P121000mDRAFT_103205LPfeb09P121000mDRAFT_1032051F004642VWLNKSKKFYDVPFWQFTMDGIQWMVLDERHGSASQFYSHYKLAKGHVICTGXGFGTREQWLASKPEVTKITVLEKFKEVIDYHKDIGTKWHDKIEIINCDANDYKGSCDFLSIDHYEYDXVLRILDSIKTVCNNITCESAWFWMLEPWIRLGYITDNTENPTIIPMKIRYGGKENDILE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.