 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000294 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045762 | Gp0053771 | Ga0010831 |
| Sample Name | Human fecal microbial communities from Cork, Ireland - EM326 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI), Macrogen |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 87074386 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Cork, Ireland | |||||||
| Coordinates | Lat. (o) | 51.907 | Long. (o) | -8.472 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071325 | Metagenome | 122 | N |
| F087334 | Metagenome | 110 | N |
| F089005 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| EM326_1003591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 5154 | Open in IMG/M |
| EM326_1018567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 761 | Open in IMG/M |
| EM326_1028066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 14620 | Open in IMG/M |
| EM326_1032871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 7106 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| EM326_1003591 | EM326_10035911 | F071325 | QYCSIFKVLLALLSDSSIVISKVILFVKHFFDIFLSFPNAFLKAFHLHAVRFPAAFLLVHRFYLAFEELLSCATAYL* |
| EM326_1018567 | EM326_10185671 | F087334 | MASRYPFVGAAAHLFPKNAIKMLSFSTSGKGSILLYPFRSSPLLAITFLYHPKDFFLYRA |
| EM326_1028066 | EM326_10280661 | F089005 | LTKSKQRSIIALALLRLATSNEESEQALKVRRTLKIEQRENS |
| EM326_1032871 | EM326_103287113 | F089005 | LTKSKQRSIIAHALAEVTASNEGSKQALKVRRTLKIEQRENS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |