Sample 3300000483

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300000483

3300000483: ZC3D30

Overview

Basic Information
IMG/M Taxon OID	3300000483 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0073241 \| Gp0054479 \| Ga0011570
Sample Name	ZC3D30
Sequencing Status	Permanent Draft
Sequencing Center	University of Sao Paulo
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	16023538
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Compost Microbial Communities From Sao Paulo Zoo, Brazil
Type	Engineered
Taxonomy	Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Sao Paulo Zoo Park
Coordinates	Lat. (^o)	-23.651079	Long. (^o)	-46.620668	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059782	Metagenome	133	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
ZC3D30_102661	Not Available	1632	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
ZC3D30_102661	ZC3D30_1026615	F059782	VRVEFETARGRIVQGKGSQVAAFFVVLGIESEQLTVPERGELLQRLTTRIVDAIAEEYGGEEIEIRRSRE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.