Basic Information | |
---|---|
IMG/M Taxon OID | 3300000688 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0075432 | Gp0054710 | Ga0001956 |
Sample Name | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 33 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 6186233 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | forest biome → tropical forest → forest soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Luquillo Experimental Forest Soil, Puerto Rico | |||||||
Coordinates | Lat. (o) | 18.0 | Long. (o) | -65.0 | Alt. (m) | N/A | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081851 | Metagenome | 114 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI12411J11895_101120 | Not Available | 598 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI12411J11895_101120 | JGI12411J11895_1011202 | F081851 | MKTQCLLRRNAYHTTAWIDTDATKLGLLVAIPELGGLWEIVEIYSYRLTRKQLKTRKTLTVIF* |
⦗Top⦘ |