Sample 3300001009

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001009

3300001009: Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN352

Overview

Basic Information
IMG/M Taxon OID	3300001009 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053063 \| Gp0054365 \| Ga0002529
Sample Name	Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN352
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	117241
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	grassland biome → land → grassland soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Chapel Hill, North Carolina, USA
Coordinates	Lat. (^o)	35.913	Long. (^o)	-79.056	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025553	Metagenome / Metatranscriptome	201	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
JGI12523J13124_1001	All Organisms → cellular organisms → Bacteria	1720	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12523J13124_1001	JGI12523J13124_10012	F025553	MKPVSWDKQLGLASPLETAASQSGKIKSPSNKEAGLDVSHHALVSREGRGENFFLDILFYRMS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.