Sample 3300001332

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001332

3300001332: Hypersaline viral communities from Bras del Port, Santa Pola, Spain

Overview

Basic Information
IMG/M Taxon OID	3300001332 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0069917 \| Gp0054897 \| Ga0011177
Sample Name	Hypersaline viral communities from Bras del Port, Santa Pola, Spain
Sequencing Status	Permanent Draft
Sequencing Center	Lifesequencing S.L.
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	118104459
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain
Type	Environmental
Taxonomy	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → saline evaporation pond → hypersaline water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Hypersaline (saline)

Location Information
Location	Mediterranean Sea
Coordinates	Lat. (^o)	38.2	Long. (^o)	0.6	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
CR30All_1000502	Not Available	603	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
CR30All_1000502	CR30All_10005023	F066493	MSEREWHDGVVDVADELVQEHSAEGAIEHLQTRRQSSSEQLQQRCTEAIAYIRREVLADE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.