Sample 3300001490

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001490

3300001490: Fosmid Clones Derived from Amazon Forest Soil Microbial Communities

Overview

Basic Information
IMG/M Taxon OID	3300001490 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0071049 \| Gp0054693 \| Ga0026097
Sample Name	Fosmid Clones Derived from Amazon Forest Soil Microbial Communities
Sequencing Status	Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	3532881
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Forest Soil Microbial Communities From The Amazon Forest, Brazil, Of Fosmid Clones
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Forest Soil → Forest Soil Microbial Communities From The Amazon Forest, Brazil, Of Fosmid Clones

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	forest biome → land → forest soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Moj? ? PA (north of Brazil).
Coordinates	Lat. (^o)	-2.5871	Long. (^o)	-49.041	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026670	Metagenome / Metatranscriptome	197	Y
F056963	Metagenome	137	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
JGI12186J15620_100053	All Organisms → cellular organisms → Bacteria	30303	Open in IMG/M
JGI12186J15620_100352	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12186J15620_100053	JGI12186J15620_1000533	F056963	LFSLFEAVAQGLAALRKNEWVEGIEERFGVVKVSVTDVRVEHQVKIADLMKWLERPGRTPREVTHRLRIRAILGMSVSR*
JGI12186J15620_100352	JGI12186J15620_1003522	F026670	ALLIILALAALITLLGSAFPLRQAAQYDPAPILRGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.