NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001793

3300001793: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Aug_CSWold



Overview

Basic Information
IMG/M Taxon OID3300001793 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053062 | Gp0055495 | Ga0004654
Sample NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Aug_CSWold
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size69308847
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSerpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zonerock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001230Metagenome / Metatranscriptome741Y
F050234Metagenome / Metatranscriptome145Y
F090615Metagenome / Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI24113J20146_1000373All Organisms → cellular organisms → Bacteria → Proteobacteria12342Open in IMG/M
JGI24113J20146_1007860Not Available1760Open in IMG/M
JGI24113J20146_1026995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI24113J20146_1000373JGI24113J20146_10003737F090615MRALQLAAPEPTDPSLIAALRVRKGWLRPDSSIVDKAAVEGLKKLGVLLCPPPDPEGKSIPAKLFNEIAAEYLKTVPQTRLLIEESAVEHQAFWDADQPYIDQSDEDIHEEMVTAIKMANADRLRAARAKASAGS*
JGI24113J20146_1007860JGI24113J20146_10078601F001230MAETAAEAVRNAHRWFEHNSGWAPPDEETLEEWAADGVCRCPDECLVAPDAWCEHGLASWALILAELDRHP*
JGI24113J20146_1026995JGI24113J20146_10269952F050234VIPPWPLLVLMLEFPVLMALLDCWQRPEDHFAEGAADRRAWLRWLLVAVVTIPVLVGYGIVLGYYYAVVRRSSPASPR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.