 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001793 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053062 | Gp0055495 | Ga0004654 |
| Sample Name | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Aug_CSWold |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 69308847 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → planetary subsurface zone → rock |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California, McLaughlin Reserve | |||||||
| Coordinates | Lat. (o) | 38.8739528 | Long. (o) | -122.4391613 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001230 | Metagenome / Metatranscriptome | 741 | Y |
| F050234 | Metagenome / Metatranscriptome | 145 | Y |
| F090615 | Metagenome / Metatranscriptome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI24113J20146_1000373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12342 | Open in IMG/M |
| JGI24113J20146_1007860 | Not Available | 1760 | Open in IMG/M |
| JGI24113J20146_1026995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI24113J20146_1000373 | JGI24113J20146_10003737 | F090615 | MRALQLAAPEPTDPSLIAALRVRKGWLRPDSSIVDKAAVEGLKKLGVLLCPPPDPEGKSIPAKLFNEIAAEYLKTVPQTRLLIEESAVEHQAFWDADQPYIDQSDEDIHEEMVTAIKMANADRLRAARAKASAGS* |
| JGI24113J20146_1007860 | JGI24113J20146_10078601 | F001230 | MAETAAEAVRNAHRWFEHNSGWAPPDEETLEEWAADGVCRCPDECLVAPDAWCEHGLASWALILAELDRHP* |
| JGI24113J20146_1026995 | JGI24113J20146_10269952 | F050234 | VIPPWPLLVLMLEFPVLMALLDCWQRPEDHFAEGAADRRAWLRWLLVAVVTIPVLVGYGIVLGYYYAVVRRSSPASPR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |