Basic Information | |
---|---|
IMG/M Taxon OID | 3300002058 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0085351 | Gp0061084 | Ga0016719 |
Sample Name | Macroalgal surface ecosystem from Botany Bay, Galicia, Spain - SR1-P2 |
Sequencing Status | Permanent Draft |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 228606952 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Macroalgal Surface Microbial Communities |
Type | Host-Associated |
Taxonomy | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Vigo, Galicia, Spain | |||||||
Coordinates | Lat. (o) | 42.52 | Long. (o) | -8.82 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028441 | Metagenome / Metatranscriptome | 191 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
SR1_1671823 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1259 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
SR1_1671823 | SR1_16718232 | F028441 | MTLKQLIKIEDKAKEVWVISPTLHYDVDNKDFSEIVSVNLGEKTKYKYIVPATSTVLKNIRRYKKMYNATESDVANNFLILPESEFNPFITESAIYDATTKCIAVSAPATDHKNEIIKFNEAAAKNLAKSFKTLWKKYKRTNP* |
⦗Top⦘ |