NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002812

3300002812: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12



Overview

Basic Information
IMG/M Taxon OID3300002812 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0072104 | Ga0007229
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1534833
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054151Metagenome / Metatranscriptome140N
F080568Metagenome / Metatranscriptome115Y
F098176Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25488J38603_10005Not Available1557Open in IMG/M
JGI25488J38603_10016Not Available1069Open in IMG/M
JGI25488J38603_10087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium605Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25488J38603_10005JGI25488J38603_100051F098176LVASYRNTSETLVPRGRKRNRMYLGLLRADLLENDGTIIAGDATAVRSAMNELNTALEGITDADPIFAPQGLAIVSPTAGECYEVNEVGCGEAVDTHRSRRQKEPENMIWQAAS*
JGI25488J38603_10016JGI25488J38603_100161F080568MAATPSIKITKQFTYRGVTKQFSNRYHFNGGTPADNAHWTTLADAIVTAEKVCYSSVVTIVKATGYAAGSEVPVFTKTYSTVGTSVWTGGTQTPGDCAAVVRYATAVRTAKNHPIYLFNYYHGAYNAAGAPDTLIAAQSGQLQAYANTWIGAGFSDGTTSYNRAGPNGATATGALVEPLISHRDLPR*
JGI25488J38603_10087JGI25488J38603_100871F054151LADHFRALAEGLSLRAVSERAPAQRAELQRLAECYAELAKQQSPADHFARGVGPR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.