 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002878 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046785 | Gp0055389 | Ga0005259 |
| Sample Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_150m_A (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 30883810 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera mobilis | 1 |
| All Organisms → Viruses → Predicted Viral | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → coastal inlet → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 48.7299 | Long. (o) | -123.5699 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029271 | Metagenome / Metatranscriptome | 189 | N |
| F075397 | Metagenome / Metatranscriptome | 119 | N |
| F102126 | Metagenome / Metatranscriptome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0005259J43196_1008218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera mobilis | 1378 | Open in IMG/M |
| Ga0005259J43196_1009947 | All Organisms → Viruses → Predicted Viral | 2237 | Open in IMG/M |
| Ga0005259J43196_1022021 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0005259J43196_1008218 | Ga0005259J43196_10082182 | F075397 | MKYWHKRVDVVSFFDLDQENQDIELKDDDNADEFAFLIAENGEYWNLDLFMRTESGRYDGVMGLTNTSAIGIVLSCSGESAVIQCFS* |
| Ga0005259J43196_1009947 | Ga0005259J43196_10099472 | F029271 | MSKLSDLQDIKELLDVDFRKDKFLDNQYNNSPSFNYDAAESYVANIHQFLSEKYGEAVIYNFMQEVESLRITTLKMYIESNIASYQKFGAQK* |
| Ga0005259J43196_1022021 | Ga0005259J43196_10220211 | F102126 | MGNKGKEKQRGQDAERLVNDPLYKEAFVTTKELLIEMLLQTAISEETERDRIYITIKSLELIDQHIKSVLETGKLAEGQHSEFYEDTNNY* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |