Sample 3300002879

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300002879

3300002879: Assembled contigs of human gut microbial metagenome from Inflammatory Bowel Disease and Treatment (7 pooled healthy)

Overview

Basic Information
IMG/M Taxon OID	3300002879 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111363 \| Gp0094530 \| Ga0048156
Sample Name	Assembled contigs of human gut microbial metagenome from Inflammatory Bowel Disease and Treatment (7 pooled healthy)
Sequencing Status	Permanent Draft
Sequencing Center	Harvard University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	34354668
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus atrophaeus	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From Healthy Individuals And Crohn's Disease Patients At Harvard School Of Public Health
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy Individuals And Crohn's Disease Patients At Harvard School Of Public Health

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Unclassified

Location Information
Location	Harvard School of Public Health, Boston, MA
Coordinates	Lat. (^o)	42.335579	Long. (^o)	-71.102733	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059106	Metagenome	134	N
F074964	Metagenome	119	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
HEA_1008745	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus atrophaeus	819	Open in IMG/M
HEA_1012533	Not Available	682	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
HEA_1008745	HEA_10087451	F074964	MITKKNVNKLQNAVIKESASNLVGAVKLYNALFANGADLKAICKTLEIPAEYAIRVATLAKDKKRLVAVCSQMLPKVGDTFVKFSLYSKVYKDNKVDKEKGIEAKTADWCAENVIYGGEYKSFGFSTAETLETKKSAKWLVKETDEYKATYVAVKIKSYSIRTIAKCVSEYLTHESNQQ*
HEA_1012533	HEA_10125332	F059106	MHAIVWKIRVILLQIFVWIVDLKVRERLTEYLKKDIKYHQVIIEVLV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.