 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002893 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047444 | Gp0096892 | Ga0051974 |
| Sample Name | PDIso3.OB1V3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | McGill University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 6644799 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Type | Environmental |
| Taxonomy | Environmental → Unclassified → Unclassified → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → fen → surface soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 51.166666 | Long. (o) | -116.15 | Alt. (m) | N/A | Depth (m) | .01 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000708 | Metagenome / Metatranscriptome | 926 | Y |
| F027362 | Metagenome / Metatranscriptome | 195 | Y |
| F032937 | Metagenome / Metatranscriptome | 178 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| draft_100010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 187878 | Open in IMG/M |
| draft_100021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 272132 | Open in IMG/M |
| draft_100089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3206 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| draft_100010 | draft_10001023 | F027362 | MTEAAQRALQAFSKGEMTALELRRRLGGATYGDVLRLLDEASLPLPRAPVHGREASLNIAREWMFPKHVP* |
| draft_100021 | draft_10002180 | F032937 | LKLVAIKALAGFNYVRPDAVIAIGATDSAKCTIYMTGGVAIPSHEPAKDVIAKLQAAEAEPETN* |
| draft_100089 | draft_1000892 | F000708 | MIKSDTTLAQIAARFAARHDVEWNRGAYVIVDRRTAHTIARLRPIPDTDRFELFYWSNVKERWTTFGNLGRMKLRLDSAHEIVENDPMFRVQRSR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |