NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003360

3300003360: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10.2A4w-11



Overview

Basic Information
IMG/M Taxon OID3300003360 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0091565 | Ga0008881
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10.2A4w-11
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size238082
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098176Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI26324J50208_1003Not Available1159Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI26324J50208_1003JGI26324J50208_10032F098176MSIVGTSEAYWLTGGGFTGWHQIHHEDENIALSTAAQLPPQCALVASYRNTSEVTVPRGRKRNRMYLGLLRADLLENDGTIIAGDATAVRAAMNELNTALEAITDADPIFAPQGLAVVSPTAGECYEVNEVGCGEAVDTHRSRRQKEPENMIWQAAS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.