Sample 3300003450

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003450

3300003450: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S7-DC07A

Overview

Basic Information
IMG/M Taxon OID	3300003450 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111425 \| Gp0104220 \| Ga0059322
Sample Name	Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S7-DC07A
Sequencing Status	Permanent Draft
Sequencing Center
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	35322702
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine neritic zone → marine sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Sediment (saline)

Location Information
Location	Douglas Channel, British Columbia, Canada
Coordinates	Lat. (^o)	53.6667	Long. (^o)	-129.1333	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040632	Metagenome / Metatranscriptome	161	Y
F104035	Metagenome	101	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
DC07A_1020326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	500	Open in IMG/M
DC07A_1046232	Not Available	525	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
DC07A_1020326	DC07A_10203261	F040632	MSHRTRGAANYEIELEDLRDAAALPDTVHVVVASREEELLWAVFDGFSELPTVRVTGCSTLPQTRQICAADPPGYLIIDMTLLDHEPMDLITLANLSNCETHIVALTDHPVFEIGARFGKARLTFLQKPVSAHDLLLLLRLRISEHDECEAKVC*
DC07A_1046232	DC07A_10462322	F104035	MTKTKEIKEKTIEKARKDAENDYQGGGAYRAFLEMFYKNKIEEDKKNGQKNSEDV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.