NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003526

3300003526: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS2_TP1_12L



Overview

Basic Information
IMG/M Taxon OID3300003526 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0107632 | Ga0060311
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS2_TP1_12L
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1890616
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available4

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationAxial seamount, northeast pacific ocean
CoordinatesLat. (o)45.933251Long. (o)-130.01379Alt. (m)N/ADepth (m)1542
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011936Metagenome / Metatranscriptome285Y
F042865Metagenome / Metatranscriptome157N
F054846Metagenome / Metatranscriptome139N
F082613Metagenome / Metatranscriptome113N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
LVWS2TP112L_11138Not Available533Open in IMG/M
LVWS2TP112L_12029Not Available855Open in IMG/M
LVWS2TP112L_12292Not Available805Open in IMG/M
LVWS2TP112L_13687Not Available521Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
LVWS2TP112L_11138LVWS2TP112L_111381F042865DFNKRIWWQFMQSVVNDLPLNGNVAPENTIRANKSCLYVESTGGTAVLWFNPNGNGSATGWIVK*
LVWS2TP112L_12029LVWS2TP112L_120292F054846MSNELDLNDLGLGDNSQSAINEKMPRRGADGRGQSRESRKSLSEHDTARKPERVPMYAQRTMIDTTLIPEGYHGHWVSNNPAGRIDMLLRAGYDFVTKDQNVYSSHVTENGVDSRVSKSGSDGVTLYLMIIPLELYEADQEAKAEKAKEQTATIFGKQRNDP
LVWS2TP112L_12292LVWS2TP112L_122921F082613LISTVLMFALDAQLNQQSIVVAGPNATTKDAGIYATKIISVTTSASASNILIGHTNVGFAHWKVIPSRGVSSTTGASIGIDGTANITLQTTFANIADNAIFAGTFDVFSHSYLAALTASAFDTIDTREIGVRLKFNSWSSGAVRLDLSVSAKG*
LVWS2TP112L_13687LVWS2TP112L_136871F011936RRKIRGVDLREQLHETRLQKLENGHDMLSRDYSRLNDAIVKISESLMALVVIQEQNKSIMQCMEHQSTTIEKLDGRIDAIELQMPQLVESRQWLMIGLGLIVTAVIVALIALVIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.