Sample 3300003528

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003528

3300003528: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS2_TP1_13H

Overview

Basic Information
IMG/M Taxon OID	3300003528 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111355 \| Gp0107634 \| Ga0060327
Sample Name	Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS2_TP1_13H
Sequencing Status	Permanent Draft
Sequencing Center
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	3129687
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Axial seamount, northeast pacific ocean
Coordinates	Lat. (^o)	45.933251	Long. (^o)	-130.01379	Alt. (m)	N/A	Depth (m)	1542
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019998	Metagenome / Metatranscriptome	226	N
F082613	Metagenome / Metatranscriptome	113	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
LVWS2TP113H_100379	Not Available	702	Open in IMG/M
LVWS2TP113H_102044	Not Available	614	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
LVWS2TP113H_100379	LVWS2TP113H_1003791	F082613	QQSVVVAGLNATTKDAGIYATKIISVTTSASASNILIGHTNVGFAPWKVIPSRGVSSTTGASIGIDGTANITLQTTFANIADNAIFAGTFDVFSHSFLAALTASAFDTVDAREIGVRLKFNSWSSGNVRLDLSVSAKG*
LVWS2TP113H_102044	LVWS2TP113H_1020441	F019998	ASVDAIVVGFTTLVWQPLRIIEARRKDLSSDIEVPLMIVGKFDYERIPNKAMASIPLWLYAQTKIAETQVFVWPPTAYANWAIGYSFERRYQDVDSGINSMDFPPEAYESLRYGLGARLGDEFPIDPQRQAMLEQKAAGYFTAMRQASSGNASVKFGVRG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.