NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003536

3300003536: Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA-2 Water



Overview

Basic Information
IMG/M Taxon OID3300003536 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0112330 | Gp0107645 | Ga0060331
Sample NamePetroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA-2 Water
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size106668796
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Kosmotogales → Kosmotogaceae → Mesotoga1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePetroleum Reservoir Microbial Communities From Reconcavo Basin, Brazil, Analyzing Oil Degradation
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir → Petroleum Reservoir Microbial Communities From Reconcavo Basin, Brazil, Analyzing Oil Degradation

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → oil reservoir → oil field production water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationBrazil: State of Brazil
CoordinatesLat. (o)-12.2Long. (o)-38.11Alt. (m)N/ADepth (m)500 to 1000
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022008Metagenome / Metatranscriptome216Y
F070092Metagenome123N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ba2Water_1004441All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Kosmotogales → Kosmotogaceae → Mesotoga6109Open in IMG/M
Ba2Water_1008399All Organisms → cellular organisms → Bacteria18115Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ba2Water_1004441Ba2Water_10044415F070092MAINDRLKPVMELLETNRQKIGLMISHGMASDLAIERRKKELYDEVMTAKENAFKEELADLEGEIKKIEYSYHEPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHTFQNTGTIPGIPWERPDHVDVLVAELRNRGLDEEADLTWDYAYNKLKVDRPWENNPLYKQLKSQQNKVSVLAGFKDMLKYLDGTNNAVYISEILKYKG*
Ba2Water_1008399Ba2Water_100839911F022008MTVSEIEMLREALADLSKQVQALSEDNRTSFGRIYDRLTKIETQMSERECQFRKFEKALDNHETRIRSVEGELGTLRDVPERLWRVSMSNSKLTGMVMAAGGMGGLVATLIVRILGE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.