 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003763 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053073 | Gp0101302 | Ga0055529 |
| Sample Name | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 147000372 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella → Bordetella sp. FB-8 | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 35.6667 | Long. (o) | -78.5097 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070251 | Metagenome | 123 | Y |
| F080973 | Metagenome | 114 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0055529_1000432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella → Bordetella sp. FB-8 | 42394 | Open in IMG/M |
| Ga0055529_1010779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola | 1185 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0055529_1000432 | Ga0055529_100043219 | F070251 | MSAPGRPKRSFPPWGEGAQRQGGAMSAPGRPKRSFPLGGKARSAKGAI* |
| Ga0055529_1010779 | Ga0055529_10107791 | F080973 | MVLAAATISMAYPTQGDVREMIAGAIGELTGTPAAEVDLGNSRVLVLTDTRSGYNWSYPDAMVKARFRPFVHRAVSMVRQQYPFLR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |